Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEK2 Peptide - C-terminal region

NEK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NEK2, NEK2A, NLK1

UniProt

P51955

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NEK2 Rabbit Polyclonal Antibody (orb588140) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSSPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB3IP (NM_001024647) Human Over-expression Lysate
LY422524 100 µg

RAB3IP (NM_001024647) Human Over-expression Lysate

Sign In for Pricing
View Details
MIR1236 Human qPCR Primer Pair (MI0006326)
HP300059 200 Reactions

MIR1236 Human qPCR Primer Pair (MI0006326)

Sign In for Pricing
View Details
Dental Autoclave BADT-103
BADT-103 1 Unit

Dental Autoclave BADT-103

Sign In for Pricing
View Details
Human WNK2 activation kit by CRISPRa
GA112260 1 Kit

Human WNK2 activation kit by CRISPRa

Sign In for Pricing
View Details
CD99 Mouse Monoclonal Antibody [Clone ID: 3B2/TA8]
AM26145AC-N 100 Tests

CD99 Mouse Monoclonal Antibody [Clone ID: 3B2/TA8]

Sign In for Pricing
View Details
Human C18orf22 (RBFA) activation kit by CRISPRa
GA112685 1 Kit

Human C18orf22 (RBFA) activation kit by CRISPRa

Sign In for Pricing
View Details