Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PALLD Peptide - N-terminal region

PALLD Peptide - N-terminal region

Product Specifications

Product Name Alternative

PALLD, KIAA0992, CGI-151

UniProt

Q8WX93

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PALLD Rabbit Polyclonal Antibody (orb331454) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005262919

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HQRKGGPQSQLCDKAANLIEELTSIFKAAKPRNRSPNGESSSPDSGYLSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horizontal Autoclave BAHZ-401-A
BAHZ-401-A 1 Unit

Horizontal Autoclave BAHZ-401-A

Sign In for Pricing
View Details
SMAD1 pSer465 Rabbit Polyclonal Antibody
AP08024PU-N 100 µL

SMAD1 pSer465 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EGR4 Rabbit Polyclonal Antibody
HA500445 100 µL

EGR4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD59 Mouse Monoclonal Antibody [Clone ID: 1F5]
AM06017FC-N 100 µg

CD59 Mouse Monoclonal Antibody [Clone ID: 1F5]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB532126 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
CENPBD1P Human Gene Knockout Kit (CRISPR)
KN418542 1 Kit

CENPBD1P Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details