PALLD Peptide - N-terminal region
PALLD Peptide - N-terminal region
Product Specifications
Product Name Alternative
PALLD, KIAA0992, CGI-151
UniProt
Q8WX93
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PALLD Rabbit Polyclonal Antibody (orb331454) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005262919
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HQRKGGPQSQLCDKAANLIEELTSIFKAAKPRNRSPNGESSSPDSGYLSP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MTRF1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D6]](https://cdn.genprice.uk/products/937/68dd1b87061270361ea21196/imageurl/ta813119bm.webp)
TA813119BM 100 µL
MTRF1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D6]
Sign In for Pricing
View Details 
#29079-KIT 1 Kit
CheetahTM FLEX HotStart Taq (500 U Taq with Buffer Pack)
Sign In for Pricing
View Details 
![CD105 (ENG) Mouse Monoclonal Antibody [Clone ID: MEM-229]](https://cdn.genprice.uk/products/937/68dd1899061270361e8fb9a6/imageurl/am03092fc-n.webp)
AM03092FC-N 100 Tests
CD105 (ENG) Mouse Monoclonal Antibody [Clone ID: MEM-229]
Sign In for Pricing
View Details 