Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAPSS2 Peptide - C-terminal region

PAPSS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SK2, BCYM4, ATPSK2

UniProt

O95340

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAPSS2 Rabbit Polyclonal Antibody (orb327250) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004661

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VILIP1 (VSNL1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G1]
TA801992BM 100 µL

VILIP1 (VSNL1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G1]

Sign In for Pricing
View Details
C-Myc (9E10.3), CF770 conjugate, 0.1mg/mL
BNC700596-500 1x 500 µL

C-Myc (9E10.3), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,3,4-Trihydroxybenzaldehyde
TRC-T795020-25G 25 g

2,3,4-Trihydroxybenzaldehyde

Sign In for Pricing
View Details
CD45RA (PTPRC/1148), Biotin conjugate, 0.1mg/mL
BNCB1148-500 1x 500 µL

CD45RA (PTPRC/1148), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FCHSD1 Human Gene Knockout Kit (CRISPR)
KN415379 1 Kit

FCHSD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF405S conjugate, 0.1mg/mL
BNC041104-500 1x 500 µL

PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details