Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAPSS2 Peptide - C-terminal region

PAPSS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SK2, BCYM4, ATPSK2

UniProt

O95340

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAPSS2 Rabbit Polyclonal Antibody (orb327250) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004661

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KLHL10 activation kit by CRISPRa
GA117320 1 Kit

Human KLHL10 activation kit by CRISPRa

Sign In for Pricing
View Details
Ankhd1 Mouse Gene Knockout Kit (CRISPR)
KN501254 1 Kit

Ankhd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-(R)-Pentylsuccinic Acid 4-tert-Butyl Ester
TRC-P284550-50MG 50 mg

2-(R)-Pentylsuccinic Acid 4-tert-Butyl Ester

Sign In for Pricing
View Details
PCNA (PCNA/694), CF568 conjugate, 0.1mg/mL
BNC680694-500 1x 500 µL

PCNA (PCNA/694), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
JUNB Human Knockdown Lysate
LY300356 100 µg

JUNB Human Knockdown Lysate

Sign In for Pricing
View Details
GPR124 (ADGRA2) Rabbit Polyclonal Antibody
TA367070 100 µL

GPR124 (ADGRA2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details