Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCOLCE Peptide - C-terminal region

PCOLCE Peptide - C-terminal region

Product Specifications

Product Name Alternative

PCPE, PCPE1, PCPE-1

UniProt

Q15113

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCOLCE Rabbit Polyclonal Antibody (orb327251) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002584

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSEGNELLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VGLUT1 Recombinant Chimeric Antibody Antibody
HA610234 100 µg

VGLUT1 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
CF®488A-dUTP, Lyophilized Powder
#40008-T 1x 5 nmol

CF®488A-dUTP, Lyophilized Powder

Sign In for Pricing
View Details
ANKRD39 (NM_016466) Human Recombinant Protein
TP307187M 100 µg

ANKRD39 (NM_016466) Human Recombinant Protein

Sign In for Pricing
View Details
Aminoacylase 1 (ACY1) Rabbit Polyclonal Antibody
TA373244 100 µL

Aminoacylase 1 (ACY1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HER2 / ErbB2 Rabbit Polyclonal Antibody
R1511-33 100 µL

HER2 / ErbB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
D 13223 (Flupirtine Metabolite)
TRC-D100065-10MG 10 mg

D 13223 (Flupirtine Metabolite)

Sign In for Pricing
View Details