Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYGM Peptide - C-terminal region

PYGM Peptide - C-terminal region

Product Specifications

Product Name Alternative

PYGM

UniProt

P11217

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PYGM Rabbit Polyclonal Antibody (orb588152) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TIGTMDGANVEMAEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tfap2a Protein Vector (Mouse) (pPM-C-His)
PV237737 500 ng

Tfap2a Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Horse Diacylglycerol Kinase Iota (DGKI) ELISA Kit
MBS9900318-01 48 Well

Horse Diacylglycerol Kinase Iota (DGKI) ELISA Kit

Sign In for Pricing
View Details
Horse Diacylglycerol Kinase Iota (DGKI) ELISA Kit
MBS9900318-02 96 Well

Horse Diacylglycerol Kinase Iota (DGKI) ELISA Kit

Sign In for Pricing
View Details
Horse Diacylglycerol Kinase Iota (DGKI) ELISA Kit
MBS9900318-03 5x 96 Well

Horse Diacylglycerol Kinase Iota (DGKI) ELISA Kit

Sign In for Pricing
View Details
Horse Diacylglycerol Kinase Iota (DGKI) ELISA Kit
MBS9900318-04 10x 96 Well

Horse Diacylglycerol Kinase Iota (DGKI) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human TJP2 shRNA (UAS) - Lentiviral human TJP2 shRNA (UAS) (25)
GTR15087281 1 Vial

Lentiviral human TJP2 shRNA (UAS) - Lentiviral human TJP2 shRNA (UAS) (25)

Sign In for Pricing
View Details