Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYGM Peptide - C-terminal region

PYGM Peptide - C-terminal region

Product Specifications

Product Name Alternative

PYGM

UniProt

P11217

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PYGM Rabbit Polyclonal Antibody (orb588152) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TIGTMDGANVEMAEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UTP14C Human shRNA Plasmid Kit (Locus ID 9724)
TR300602 1 Kit

UTP14C Human shRNA Plasmid Kit (Locus ID 9724)

Sign In for Pricing
View Details
Lentiviral mouse Gch1 shRNA (UAS) - Lentiviral mouse Gch1 shRNA (UAS) (25)
GTR15297968 1 Vial

Lentiviral mouse Gch1 shRNA (UAS) - Lentiviral mouse Gch1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Mouse Monoclonal FCAR/CD89 Antibody (MIP8a) [PE/Cy5.5]
NB100-63266PECY55 0.1 mL

Mouse Monoclonal FCAR/CD89 Antibody (MIP8a) [PE/Cy5.5]

Sign In for Pricing
View Details
Human HMG20B protein
orb1463792-01 50 µg

Human HMG20B protein

Sign In for Pricing
View Details
Human HMG20B protein
orb1463792-02 100 µg

Human HMG20B protein

Sign In for Pricing
View Details
Human HMG20B protein
orb1463792-03 200 µg

Human HMG20B protein

Sign In for Pricing
View Details