RASA3 Peptide - N-terminal region
RASA3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RASA3
UniProt
Q14644
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RASA3 Rabbit Polyclonal Antibody (orb588157) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_031394
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YEAWYFLQPRDNGSKSLKPDDLGSLRLNVVYTEDHVFSSDYYSPLRDLLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
EWB97457-01 50 mg
4-Thiomorpholinesulfonyl chloride 1, 1-dioxide
Sign In for Pricing
View Details EWB97457-02 0.5 g
4-Thiomorpholinesulfonyl chloride 1, 1-dioxide
Sign In for Pricing
View Details orb3109536 100 µg
Cytokeratin 20/Krt20 Rabbit Polyclonal Antibody (Fluoro488)
Sign In for Pricing
View Details 384622 96 Tests
TH (Tyrosine Hydroxylase) BioAssayTM ELISA Kit (Mouse) discontinued
Sign In for Pricing
View Details