Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFC5 Peptide - N-terminal region

RFC5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RFC5

UniProt

P40937

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RFC5 Rabbit Polyclonal Antibody (orb327264) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYGPPGTGKTSTILA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proliferating Rat Dermal Fibroblasts (RDF), adult
R107-24Wa 24 Well

Proliferating Rat Dermal Fibroblasts (RDF), adult

Sign In for Pricing
View Details
Lrrc46 (NM_001004201) Rat Tagged ORF Clone
RR203958 10 µg

Lrrc46 (NM_001004201) Rat Tagged ORF Clone

Sign In for Pricing
View Details
RGD1306739 Protein Vector (Rat) (pPM-C-HA)
PV299316 500 ng

RGD1306739 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
UBAC2-set siRNA/shRNA/RNAi Lentivector (Human)
48928091 4x 500 ng

UBAC2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
ESC swab Buffered Peptone Water 10 mL
85603 100/Pack

ESC swab Buffered Peptone Water 10 mL

Sign In for Pricing
View Details
FAM61B Polyclonal Antibody
bs-11001R 100 µL

FAM61B Polyclonal Antibody

Sign In for Pricing
View Details