Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFC5 Peptide - N-terminal region

RFC5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RFC5

UniProt

P40937

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RFC5 Rabbit Polyclonal Antibody (orb327264) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYGPPGTGKTSTILA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-TBPL1 Plasmid
PVT13202 2 µg

pCMV-SPORT6-TBPL1 Plasmid

Sign In for Pricing
View Details
Fpr3 Mouse shRNA Lentiviral Particle (Locus ID 14294)
TL516057V 500 µL Each

Fpr3 Mouse shRNA Lentiviral Particle (Locus ID 14294)

Sign In for Pricing
View Details
AMV Reverse Transcriptase
MBT073-100U 1 unit

AMV Reverse Transcriptase

Sign In for Pricing
View Details
Pde10a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7529707 1.0 µg DNA

Pde10a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
MMP3, ID (Stromelysin-1, SL-1, Matrix Metalloproteinase-3, MMP-3, Transin-1, STMY1) (FITC)
MBS6486983-01 0.2 mL

MMP3, ID (Stromelysin-1, SL-1, Matrix Metalloproteinase-3, MMP-3, Transin-1, STMY1) (FITC)

Sign In for Pricing
View Details
MMP3, ID (Stromelysin-1, SL-1, Matrix Metalloproteinase-3, MMP-3, Transin-1, STMY1) (FITC)
MBS6486983-02 5x 0.2 mL

MMP3, ID (Stromelysin-1, SL-1, Matrix Metalloproteinase-3, MMP-3, Transin-1, STMY1) (FITC)

Sign In for Pricing
View Details