RGS1 Peptide - N-terminal region
RGS1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RGS1,1R20, BL34, IER1
UniProt
Q08116
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RGS1 Rabbit Polyclonal Antibody (orb588159) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002913
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPHLESGMKSSKSKDVLS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880641-100 1x 100 µL
Chromogranin A (LK2H10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880960-100 1x 100 µL
MUC1 / EMA / CD227 (Epithelial Marker) (rMUC1/960), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681773-500 1x 500 µL
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1773R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881982-500 1x 500 µL
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1982), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402488-500 1x 500 µL
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details