Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPE65 Peptide - middle region

RPE65 Peptide - middle region

Product Specifications

Product Name Alternative

RPE65

UniProt

Q16518

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPE65 Rabbit Polyclonal Antibody (orb331459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000320

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYLNNKYRTSPFN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Efnb3 activation kit by CRISPRa
GA201195 1 Kit

Mouse Efnb3 activation kit by CRISPRa

Sign In for Pricing
View Details
LSM11 Mouse Monoclonal Antibody [Clone ID: OTI2G7]
CF810004 100 µg

LSM11 Mouse Monoclonal Antibody [Clone ID: OTI2G7]

Sign In for Pricing
View Details
STEAP3 (NM_001008410) Human Over-expression Lysate
LC425238 20 µg

STEAP3 (NM_001008410) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Crmp1 activation kit by CRISPRa
GA200880 1 Kit

Mouse Crmp1 activation kit by CRISPRa

Sign In for Pricing
View Details
Ferritin Light Chain Antibody
KC-6018-01 50 μL

Ferritin Light Chain Antibody

Sign In for Pricing
View Details
Ferritin Light Chain Antibody
KC-6018-02 100 µL

Ferritin Light Chain Antibody

Sign In for Pricing
View Details