Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPE65 Peptide - middle region

RPE65 Peptide - middle region

Product Specifications

Product Name Alternative

RPE65

UniProt

Q16518

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPE65 Rabbit Polyclonal Antibody (orb331459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000320

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYLNNKYRTSPFN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Testis
CS803106 5x 5 µm

Tissue FFPE Sections, Testis

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (rB22.1), 1mg/mL
BNUM2175-50 1x 50 µL

Cytokeratin 8 (KRT8) (rB22.1), 1mg/mL

Sign In for Pricing
View Details
Recombinant CDKN2A Antibody
RC-5152-01 50 μL

Recombinant CDKN2A Antibody

Sign In for Pricing
View Details
Recombinant CDKN2A Antibody
RC-5152-02 100 µL

Recombinant CDKN2A Antibody

Sign In for Pricing
View Details
Recombinant CDKN2A Antibody
RC-5152-03 1 mL

Recombinant CDKN2A Antibody

Sign In for Pricing
View Details
Human UPB1 activation kit by CRISPRa
GA109965 1 Kit

Human UPB1 activation kit by CRISPRa

Sign In for Pricing
View Details