Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS19 Peptide - C-terminal region

RPS19 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DBA, S19, DBA1, eS19

UniProt

P39019

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS19 Rabbit Polyclonal Antibody (orb327268) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bulk Human IgG4 (IB4) Isotype Control S228P - Extremely Low Endotoxin
ICH2257ELS228P-25mg 25 mg

Bulk Human IgG4 (IB4) Isotype Control S228P - Extremely Low Endotoxin

Sign In for Pricing
View Details
Monkey HERV-W_7q21.2 Provirus Ancestral Env Polyprotein (ERVWE1) ELISA Kit
MBS9389565-01 48 Well

Monkey HERV-W_7q21.2 Provirus Ancestral Env Polyprotein (ERVWE1) ELISA Kit

Sign In for Pricing
View Details
Monkey HERV-W_7q21.2 Provirus Ancestral Env Polyprotein (ERVWE1) ELISA Kit
MBS9389565-02 96 Well

Monkey HERV-W_7q21.2 Provirus Ancestral Env Polyprotein (ERVWE1) ELISA Kit

Sign In for Pricing
View Details
Monkey HERV-W_7q21.2 Provirus Ancestral Env Polyprotein (ERVWE1) ELISA Kit
MBS9389565-03 5x 96 Well

Monkey HERV-W_7q21.2 Provirus Ancestral Env Polyprotein (ERVWE1) ELISA Kit

Sign In for Pricing
View Details
Monkey HERV-W_7q21.2 Provirus Ancestral Env Polyprotein (ERVWE1) ELISA Kit
MBS9389565-04 10x 96 Well

Monkey HERV-W_7q21.2 Provirus Ancestral Env Polyprotein (ERVWE1) ELISA Kit

Sign In for Pricing
View Details
SLC27A4 Antibody
orb352514-01 50 μL

SLC27A4 Antibody

Sign In for Pricing
View Details