RPS19 Peptide - C-terminal region
RPS19 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DBA, S19, DBA1, eS19
UniProt
P39019
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RPS19 Rabbit Polyclonal Antibody (orb327268) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001013
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6349385-01 0.2 mL
SNRNP40, ID (SNRNP40, PRP8BP, SFP38, WDR57, U5 small nuclear ribonucleoprotein 40kD protein, 38kD-splicing factor, Prp8-binding protein, U5 snRNP-specific 40kD protein, WD repeat-containing protein 57) (PE)
Sign In for Pricing
View Details MBS6349385-02 5x 0.2 mL
SNRNP40, ID (SNRNP40, PRP8BP, SFP38, WDR57, U5 small nuclear ribonucleoprotein 40kD protein, 38kD-splicing factor, Prp8-binding protein, U5 snRNP-specific 40kD protein, WD repeat-containing protein 57) (PE)
Sign In for Pricing
View Details 