Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTEL1 Peptide - C-terminal region

RTEL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RTEL1, C20orf41, KIAA1088, NHL

UniProt

Q9NZ71

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RTEL1 Rabbit Polyclonal Antibody (orb588162) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGRPHLSPRPPPTGDPGSQPQWGSGVPRAGKQGQHAVSAYLADARRALGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat CXCR6 MAb (Clone 879112R)
MAB8196R-SP 25 µg

Rat CXCR6 MAb (Clone 879112R)

Sign In for Pricing
View Details
SPATC1 Protein Vector (Mouse) (pPM-C-HA)
45237024 500 ng

SPATC1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
LMTK2 Blocking Peptide
abx063746-01 1 mg

LMTK2 Blocking Peptide

Sign In for Pricing
View Details
LMTK2 Blocking Peptide
abx063746-02 5 mg

LMTK2 Blocking Peptide

Sign In for Pricing
View Details
MARVELD1 Antibody : Biotin (OAPB01000-Biotin)
OAPB01000-100UG-Biotin 0.1 mg

MARVELD1 Antibody : Biotin (OAPB01000-Biotin)

Sign In for Pricing
View Details
Human ADAM metallopeptidase with thrombospondin type 1 motif 18 (ADAMTS18) ELISA Kit
CK-bio-10002-01 48 Tests

Human ADAM metallopeptidase with thrombospondin type 1 motif 18 (ADAMTS18) ELISA Kit

Sign In for Pricing
View Details