Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTEL1 Peptide - C-terminal region

RTEL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RTEL1, C20orf41, KIAA1088, NHL

UniProt

Q9NZ71

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RTEL1 Rabbit Polyclonal Antibody (orb588162) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGRPHLSPRPPPTGDPGSQPQWGSGVPRAGKQGQHAVSAYLADARRALGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AF647 Anti-Mouse CD122 Antibody
RD20478F-01 25 µg

AF647 Anti-Mouse CD122 Antibody

Sign In for Pricing
View Details
AF647 Anti-Mouse CD122 Antibody
RD20478F-02 100 µg

AF647 Anti-Mouse CD122 Antibody

Sign In for Pricing
View Details
Recombinant Xenopus laevis Solute carrier family 25 member 46-A (slc25a46-a), partial
MBS7087745 Inquire

Recombinant Xenopus laevis Solute carrier family 25 member 46-A (slc25a46-a), partial

Sign In for Pricing
View Details
Recombinant Human EIF2B3
orb1952700-01 50 µg

Recombinant Human EIF2B3

Sign In for Pricing
View Details
Recombinant Human EIF2B3
orb1952700-02 100 µg

Recombinant Human EIF2B3

Sign In for Pricing
View Details
Recombinant Human EIF2B3
orb1952700-03 200 µg

Recombinant Human EIF2B3

Sign In for Pricing
View Details