Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGLEC8 Peptide - C-terminal region

SIGLEC8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SAF2, SIGLEC-8, SIGLEC8L

UniProt

Q9NYZ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SIGLEC8 Rabbit Polyclonal Antibody (orb327273) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055257

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESWKDGNPLKKPPPAVAPSSGEEGELHYATLSFHKVKPQDPQGQEATDSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Soft tissue
CR562090 5 µg

Tissue Total RNA, Soft tissue

Sign In for Pricing
View Details
ZAP70 (ZAP70/528 + 2F3.2), CF405S conjugate, 0.1mg/mL
BNC041137-100 1x 100 µL

ZAP70 (ZAP70/528 + 2F3.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MRPL15 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]
TA807409BM 100 µL

MRPL15 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS632954 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Nephrin (NPHS1) Mouse Monoclonal Antibody [Clone ID: OTI9D3]
CF813414 100 µg

Nephrin (NPHS1) Mouse Monoclonal Antibody [Clone ID: OTI9D3]

Sign In for Pricing
View Details
OR6N2 (C-term) Rabbit Polyclonal Antibody
AP53098PU-N 400 µL

OR6N2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details