Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGLEC8 Peptide - C-terminal region

SIGLEC8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SAF2, SIGLEC-8, SIGLEC8L

UniProt

Q9NYZ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SIGLEC8 Rabbit Polyclonal Antibody (orb327273) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055257

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESWKDGNPLKKPPPAVAPSSGEEGELHYATLSFHKVKPQDPQGQEATDSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFX5 Goat Polyclonal Antibody
AP32341PU-N 100 µg

RFX5 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin E1 (CCNE1) Rabbit Monoclonal Antibody [Clone ID: R08-2A1]
TA383909 100 µL

Cyclin E1 (CCNE1) Rabbit Monoclonal Antibody [Clone ID: R08-2A1]

Sign In for Pricing
View Details
CF®633 Goat Anti-Mouse IgG3 (γ3), 2mg/mL
#20928-250uL 1x 250 µL

CF®633 Goat Anti-Mouse IgG3 (γ3), 2mg/mL

Sign In for Pricing
View Details
Cenpn Mouse Gene Knockout Kit (CRISPR)
KN503135 1 Kit

Cenpn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SPIRE1 Rabbit Polyclonal Antibody
TA370284 100 µL

SPIRE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
p38 MAPK Polyclonal Antibody
E-AB-67671-01 60 µL

p38 MAPK Polyclonal Antibody

Sign In for Pricing
View Details