SIRT3 Peptide - N-terminal region
SIRT3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
SIR2L3
UniProt
Q9NTG7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SIRT3 Rabbit Polyclonal Antibody (orb327274) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036371
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AAAPSFFFSSIKGGRRSISFSVGASSVVGSGGSSDKGKLSLQDVAELIRA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details