Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35D1 Peptide - C-terminal region

SLC35D1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SHNKND, UGTREL7

UniProt

Q9NTN3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC35D1 Rabbit Polyclonal Antibody (orb327277) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055954

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSEANNKLDIKGKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

StrandBrite™ Green Fluorimetric RNA Quantitation Kit
17656-AAT 100 Tests

StrandBrite™ Green Fluorimetric RNA Quantitation Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS625699 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
CD47 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H5]
TA813263AM 100 µL

CD47 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H5]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Endometrium
CB508844 1 Block

Frozen Tissue Blocks, Endometrium

Sign In for Pricing
View Details
Polystyrene AM NH₂
H40045002.5G 5 g

Polystyrene AM NH₂

Sign In for Pricing
View Details
Ibuprofen Sodium Salt Dihydrate
TRC-I400155-50G 50 g

Ibuprofen Sodium Salt Dihydrate

Sign In for Pricing
View Details