Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35D1 Peptide - C-terminal region

SLC35D1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SHNKND, UGTREL7

UniProt

Q9NTN3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC35D1 Rabbit Polyclonal Antibody (orb327277) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055954

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSEANNKLDIKGKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP3 antibody
FNab09323 100 µg

USP3 antibody

Sign In for Pricing
View Details
Mouse Cyp2d10 activation kit by CRISPRa
GA200988 1 Kit

Mouse Cyp2d10 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant ApoA4 Antibody
RC-16147-01 50 μL

Recombinant ApoA4 Antibody

Sign In for Pricing
View Details
Recombinant ApoA4 Antibody
RC-16147-02 100 µL

Recombinant ApoA4 Antibody

Sign In for Pricing
View Details
Recombinant ApoA4 Antibody
RC-16147-03 1 mL

Recombinant ApoA4 Antibody

Sign In for Pricing
View Details
4"-Desmorpholino,-4"-morpholin-3-on-4-yl Momelotinib Benzoic Acid
TRC-D965670-5MG 5 mg

4"-Desmorpholino,-4"-morpholin-3-on-4-yl Momelotinib Benzoic Acid

Sign In for Pricing
View Details