SMURF1 Peptide - N-terminal region
SMURF1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
KIAA1625
UniProt
Q9HCE7
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SMURF1 Rabbit Polyclonal Antibody (orb327278) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741231-500 1x 500 µL
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401045-500 1x 500 µL
CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details