SNRPB Peptide - middle region
SNRPB Peptide - middle region
Product Specifications
Product Name Alternative
COD, CCMS, SNRPB1, SmB/B&apos, , Sm-B/B&apos, , snRNP-B, SmB/SmB&apos
UniProt
P14678
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SNRPB Rabbit Polyclonal Antibody (orb327279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
QY-E21175 96 Tests
Mouse Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
Sign In for Pricing
View Details 
MBS9906487 Inquire
Fish Immunoglobulin Lambda-Like Polypeptide 1 (IgLL1) ELISA Kit
Sign In for Pricing
View Details TMAC-04128-01 50 μL
Anti-Phospho-NTRK2 (Tyr706, 707) Polyclonal Antibody
Sign In for Pricing
View Details