Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRPB Peptide - middle region

SNRPB Peptide - middle region

Product Specifications

Product Name Alternative

COD, CCMS, SNRPB1, SmB/B&apos, , Sm-B/B&apos, , snRNP-B, SmB/SmB&apos

UniProt

P14678

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNRPB Rabbit Polyclonal Antibody (orb327279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bordetella Avium adk Protein (aa 1-218)
VAng-Lsx4241-500gEcoli 500 µg (E. coli)

Recombinant Bordetella Avium adk Protein (aa 1-218)

Sign In for Pricing
View Details
Ecto-NOX disulfide-thiol exchanger 2
MBS2889273 Inquire

Ecto-NOX disulfide-thiol exchanger 2

Sign In for Pricing
View Details
Recombinant Human CD344 protein, C-His Tag
MBS1560036-01 0.05 mg

Recombinant Human CD344 protein, C-His Tag

Sign In for Pricing
View Details
Recombinant Human CD344 protein, C-His Tag
MBS1560036-02 0.1 mg

Recombinant Human CD344 protein, C-His Tag

Sign In for Pricing
View Details
Recombinant Human CD344 protein, C-His Tag
MBS1560036-03 5x 0.1 mg

Recombinant Human CD344 protein, C-His Tag

Sign In for Pricing
View Details
SHISA5 (NM_001272068) Human Tagged ORF Clone
RC233447 10 µg

SHISA5 (NM_001272068) Human Tagged ORF Clone

Sign In for Pricing
View Details