Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK24 Peptide - C-terminal region

STK24 Peptide - C-terminal region

Product Specifications

Product Name Alternative

STK24, MST3, STK3

UniProt

Q9Y6E0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STK24 Rabbit Polyclonal Antibody (orb331463) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003567

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Papillomavirus 16 (HPV-16) (CAMVIR-1), 0.2mg/mL
BNUB0502-100 1x 100 µL

Human Papillomavirus 16 (HPV-16) (CAMVIR-1), 0.2mg/mL

Sign In for Pricing
View Details
Human SSX2IP activation kit by CRISPRa
GA114634 1 Kit

Human SSX2IP activation kit by CRISPRa

Sign In for Pricing
View Details
CATSPER3 Human qPCR Primer Pair (NM_178019)
HP218748 200 Reactions

CATSPER3 Human qPCR Primer Pair (NM_178019)

Sign In for Pricing
View Details
HypoGel® 400 CHO
SP40011015006.5G 5 g

HypoGel® 400 CHO

Sign In for Pricing
View Details
Oxyresveratrol
TRC-O861920-50MG 50 mg

Oxyresveratrol

Sign In for Pricing
View Details
Stat-1 alpha/beta Rabbit Polyclonal Antibody
ER31221 100 µL

Stat-1 alpha/beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details