Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK24 Peptide - C-terminal region

STK24 Peptide - C-terminal region

Product Specifications

Product Name Alternative

STK24, MST3, STK3

UniProt

Q9Y6E0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STK24 Rabbit Polyclonal Antibody (orb331463) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003567

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR3H Mouse Monoclonal Antibody [Clone ID: OTI4D8]
CF809432 100 µg

POLR3H Mouse Monoclonal Antibody [Clone ID: OTI4D8]

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL
BNC400003-100 1x 100 µL

CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIM 3 (HAVCR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]
TA812558AM 100 µL

TIM 3 (HAVCR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]

Sign In for Pricing
View Details
C19orf34 (NM_152771) Human Recombinant Protein
TP306937L 1 mg

C19orf34 (NM_152771) Human Recombinant Protein

Sign In for Pricing
View Details
CST6 (NM_001323) Human Over-expression Lysate
LY400530 100 µg

CST6 (NM_001323) Human Over-expression Lysate

Sign In for Pricing
View Details
OR9G4 (C-term) Rabbit Polyclonal Antibody
AP53112PU-N 400 µL

OR9G4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details