TBX1 Peptide - middle region
TBX1 Peptide - middle region
Product Specifications
Product Name Alternative
TBX1
UniProt
O43435
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TBX1 Rabbit Polyclonal Antibody (orb588183) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_006724375
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FAKGFRDCDPEDWPRNHRPGALPLMSAFARSRNPVASPTQPSGTEKDAAE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401582-100 1x 100 µL
Spectrin beta III (SPTBN2) (SPTBN2/1582), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details abx523156 96 Tests
Human Putative protein FAM90A24P (FAM90A24P) ELISA Kit
Sign In for Pricing
View Details 