TBX1 Peptide - middle region
TBX1 Peptide - middle region
Product Specifications
Product Name Alternative
TBX1
UniProt
O43435
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TBX1 Rabbit Polyclonal Antibody (orb588183) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_006724375
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FAKGFRDCDPEDWPRNHRPGALPLMSAFARSRNPVASPTQPSGTEKDAAE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CAU30689-01 100 µL
Peroxisome Proliferator Activated Receptor Gamma (PPARg) Monoclonal Antibody
Sign In for Pricing
View Details CAU30689-02 200 µL
Peroxisome Proliferator Activated Receptor Gamma (PPARg) Monoclonal Antibody
Sign In for Pricing
View Details CAU30689-03 1 mL
Peroxisome Proliferator Activated Receptor Gamma (PPARg) Monoclonal Antibody
Sign In for Pricing
View Details 37936061 1.0 µg DNA
PSMA2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details