Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THY1 Peptide - N-terminal region

THY1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

THY1

UniProt

P04216

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THY1 Rabbit Polyclonal Antibody (orb327282) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006279

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC19 Antibody
5643-01 0.02 mg

LRRC19 Antibody

Sign In for Pricing
View Details
LRRC19 Antibody
5643-02 0.1 mg

LRRC19 Antibody

Sign In for Pricing
View Details
ETV3 Recombinant Protein (Mouse)
RP132392 100 µg

ETV3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
B4GALT3 (B4GALT2) CytoSection
TS411753P5 25 Slides

B4GALT3 (B4GALT2) CytoSection

Sign In for Pricing
View Details
IL22 RA2 (IL22RA2) (NM_181309) Human Over-expression Lysate
LH16994V 100 µg

IL22 RA2 (IL22RA2) (NM_181309) Human Over-expression Lysate

Sign In for Pricing
View Details
C1orf131 3'UTR Luciferase Stable Cell Line
TU002078 1.0 mL

C1orf131 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details