Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP2 Peptide - C-terminal region

TIMP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TIMP2

UniProt

P16035

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TIMP2 Rabbit Polyclonal Antibody (orb588185) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003246

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP27B1 (NM_000785) Human Over-expression Lysate
LC400269 20 µg

CYP27B1 (NM_000785) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Liver
CB511859 1 Block

Frozen Tissue Blocks, Liver

Sign In for Pricing
View Details
(16Alpha,17Alpha)-Epoxy 16,17-Dihydroabiraterone
TRC-E589335-5MG 5 mg

(16Alpha,17Alpha)-Epoxy 16,17-Dihydroabiraterone

Sign In for Pricing
View Details
Velpatasvir
TRC-V116000-25MG 25 mg

Velpatasvir

Sign In for Pricing
View Details
PDE7B (NM_018945) Human Recombinant Protein
TP310416 20 µg

PDE7B (NM_018945) Human Recombinant Protein

Sign In for Pricing
View Details
IDH1 (IDH1/1152), CF568 conjugate, 0.1mg/mL
BNC681152-100 1x 100 µL

IDH1 (IDH1/1152), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details