TIMP2 Peptide - C-terminal region
TIMP2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
TIMP2
UniProt
P16035
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TIMP2 Rabbit Polyclonal Antibody (orb588185) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003246
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYIS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GA103645 1 Kit
Human DNA polymerase alpha (POLA1) activation kit by CRISPRa
Sign In for Pricing
View Details ![Elab Fluor® 647 Anti-Human CD27 Antibody[O323]](https://cdn.genprice.uk/products/763/68dd14a1061270361e7d0963/imageurl/e-ab-f1140m.webp)
E-AB-F1140M-01 20 Tests
Elab Fluor® 647 Anti-Human CD27 Antibody[O323]
Sign In for Pricing
View Details E-AB-F1140M-02 100 Tests
Elab Fluor® 647 Anti-Human CD27 Antibody[O323]
Sign In for Pricing
View Details E-AB-F1140M-03 2x 100 Tests
Elab Fluor® 647 Anti-Human CD27 Antibody[O323]
Sign In for Pricing
View Details 