Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBB2A Peptide - C-terminal region

TUBB2A Peptide - C-terminal region

Product Specifications

Product Name Alternative

TUBB, TUBB2, CDCBM5

UniProt

Q13885

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TUBB2A Rabbit Polyclonal Antibody (orb327285) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001060

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-1 Rrp2 Protein (Asp 20-Arg 335) [Fc]
VAng-1757Lsx-100g 100 µg

Human IL-1 Rrp2 Protein (Asp 20-Arg 335) [Fc]

Sign In for Pricing
View Details
KIAA0368 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1134408 1.0 µg DNA

KIAA0368 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
CD3EAP discontinued
309870 100 µL

CD3EAP discontinued

Sign In for Pricing
View Details
Bdh1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4534802 1.0 µg DNA

Bdh1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
N-Alpha-Acetyltransferase 20 (NAA20) Antibody
abx322708-01 20 µL

N-Alpha-Acetyltransferase 20 (NAA20) Antibody

Sign In for Pricing
View Details
N-Alpha-Acetyltransferase 20 (NAA20) Antibody
abx322708-02 50 µL

N-Alpha-Acetyltransferase 20 (NAA20) Antibody

Sign In for Pricing
View Details