Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBB2A Peptide - C-terminal region

TUBB2A Peptide - C-terminal region

Product Specifications

Product Name Alternative

TUBB, TUBB2, CDCBM5

UniProt

Q13885

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TUBB2A Rabbit Polyclonal Antibody (orb327285) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001060

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HJV (Hemojuvelin) ELISA Kit
RE3091H-01 48 Tests

Human HJV (Hemojuvelin) ELISA Kit

Sign In for Pricing
View Details
Human HJV (Hemojuvelin) ELISA Kit
RE3091H-02 96 Tests

Human HJV (Hemojuvelin) ELISA Kit

Sign In for Pricing
View Details
NOTCH2NL Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV705592 1.0 µg DNA

NOTCH2NL Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Mouse SMG5 siRNA
abx934370-01 15 nmol

Mouse SMG5 siRNA

Sign In for Pricing
View Details
Mouse SMG5 siRNA
abx934370-02 30 nmol

Mouse SMG5 siRNA

Sign In for Pricing
View Details
Polyclonal Goat Anti-PPP1R15A / GADD34 Antibody
APG00250G 0.1mg

Polyclonal Goat Anti-PPP1R15A / GADD34 Antibody

Sign In for Pricing
View Details