Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VCAM1 Peptide - C-terminal region

VCAM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

VCAM1, L1CAM

UniProt

P19320

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VCAM1 Rabbit Polyclonal Antibody (orb588192) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JC -10 in DMSO (5 x 50 µL)
5110 5x 50 µL

JC -10 in DMSO (5 x 50 µL)

Sign In for Pricing
View Details
Artemin (ARTN) Mouse Monoclonal Antibody [Clone ID: 2G7]
AM33450PU-N 100 µg

Artemin (ARTN) Mouse Monoclonal Antibody [Clone ID: 2G7]

Sign In for Pricing
View Details
Tenascin (T2H5), CF594 conjugate, 0.1mg/mL
BNC940392-100 1x 100 µL

Tenascin (T2H5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
c-Jun (JUN) Human Knockdown Lysate
LY300355 100 µg

c-Jun (JUN) Human Knockdown Lysate

Sign In for Pricing
View Details
p47-phox Mouse Monoclonal Antibody [A6B10]
HA600050 100 µL

p47-phox Mouse Monoclonal Antibody [A6B10]

Sign In for Pricing
View Details
HNF 4 alpha (HNF4A) (NM_001030003) Human Over-expression Lysate
LY422283 100 µg

HNF 4 alpha (HNF4A) (NM_001030003) Human Over-expression Lysate

Sign In for Pricing
View Details