Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VCAM1 Peptide - C-terminal region

VCAM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

VCAM1, L1CAM

UniProt

P19320

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VCAM1 Rabbit Polyclonal Antibody (orb588192) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG (H&L) Antibody Fluorescein Conjugated
TA397734 2 mg

Human IgG (H&L) Antibody Fluorescein Conjugated

Sign In for Pricing
View Details
Ac-DEVD-CHO *CAS 169332-60-9*
13403-AAT 1 mg

Ac-DEVD-CHO *CAS 169332-60-9*

Sign In for Pricing
View Details
Carbonic Anhydrase VIII (CPTC-CA8-2), CF647 conjugate, 0.1mg/mL
BNC472232-100 1x 100 µL

Carbonic Anhydrase VIII (CPTC-CA8-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BRCA1 Human Gene Knockout Kit (CRISPR)
KN218505RB 1 Kit

BRCA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Eph receptor B6 (EPHB6) (N-term) Rabbit Polyclonal Antibody
AP14302PU-N 400 µL

Eph receptor B6 (EPHB6) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LMO2 (B-Cell Marker) (rLMO2/1971), 0.2mg/mL
BNUB3806-100 1x 100 µL

LMO2 (B-Cell Marker) (rLMO2/1971), 0.2mg/mL

Sign In for Pricing
View Details