Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WWTR1 Peptide - C-terminal region

WWTR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

WWTR1, TAZ

UniProt

Q9GZV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WWTR1 Rabbit Polyclonal Antibody (orb588199) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056287

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Poliovirus Receptor/PVR Recombinant Rabbit monoclonal Antibody
HA723466B 100 µL

Human Poliovirus Receptor/PVR Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
KLF6 (NM_001300) Human Over-expression Lysate
LY400520 100 µg

KLF6 (NM_001300) Human Over-expression Lysate

Sign In for Pricing
View Details
5-Aminotricyclo[3.3.1.13,7]decane-1,3-diol
TRC-A633195-5MG 5 mg

5-Aminotricyclo[3.3.1.13,7]decane-1,3-diol

Sign In for Pricing
View Details
FOXP3 Mouse Monoclonal Antibody [Clone ID: OTI3H2]
CF810552 100 µg

FOXP3 Mouse Monoclonal Antibody [Clone ID: OTI3H2]

Sign In for Pricing
View Details
MMAB Antibody
OC-161-01 50 μL

MMAB Antibody

Sign In for Pricing
View Details
MMAB Antibody
OC-161-02 100 µL

MMAB Antibody

Sign In for Pricing
View Details