Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WWTR1 Peptide - C-terminal region

WWTR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

WWTR1, TAZ

UniProt

Q9GZV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WWTR1 Rabbit Polyclonal Antibody (orb588199) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056287

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 5/6/18 (LP34), 0.2mg/mL
BNUB2036-500 1x 500 µL

Cytokeratin 5/6/18 (LP34), 0.2mg/mL

Sign In for Pricing
View Details
Caspase-6 (CASP6) Mouse Monoclonal Antibody [Clone ID: MCH2 14 1-190]
AM05283PU-N 100 µg

Caspase-6 (CASP6) Mouse Monoclonal Antibody [Clone ID: MCH2 14 1-190]

Sign In for Pricing
View Details
Human Nuclear Antigen (NM106), Biotin conjugate, 0.1mg/mL
BNCB0106-500 1x 500 µL

Human Nuclear Antigen (NM106), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Rectum
CS636093 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details
PDIA3 / ERp57 Recombinant Rabbit monoclonal Antibody
HA751244 100 µL

PDIA3 / ERp57 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Rfx1 Rabbit Polyclonal Antibody
TA363182 100 µL

Rfx1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details