Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTB Peptide - N-terminal region

ACTB Peptide - N-terminal region

Product Specifications

Product Name Alternative

ACTB

UniProt

P60709

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTB Rabbit Polyclonal Antibody (orb588202) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001092

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse FGF R2 (IIIb) Protein, His Tag
orb750335-01 1 mg

Mouse FGF R2 (IIIb) Protein, His Tag

Sign In for Pricing
View Details
Mouse FGF R2 (IIIb) Protein, His Tag
orb750335-02 100 µg

Mouse FGF R2 (IIIb) Protein, His Tag

Sign In for Pricing
View Details
Rabbit Monoclonal Dkk-1 Antibody (004) [DyLight 488]
NBP2-89309G 0.1 mL

Rabbit Monoclonal Dkk-1 Antibody (004) [DyLight 488]

Sign In for Pricing
View Details
Anxa1, Recombinant, Mouse, aa1-346, His-Tag (Annexin A1)
217943-01 100 µg

Anxa1, Recombinant, Mouse, aa1-346, His-Tag (Annexin A1)

Sign In for Pricing
View Details
Anxa1, Recombinant, Mouse, aa1-346, His-Tag (Annexin A1)
217943-02 500 µg

Anxa1, Recombinant, Mouse, aa1-346, His-Tag (Annexin A1)

Sign In for Pricing
View Details
GENLISA™ Human NLR Family (Pyrin Domain Containing Protein 3 (NLRP3) ELISA
KBH3886 96 Well

GENLISA™ Human NLR Family (Pyrin Domain Containing Protein 3 (NLRP3) ELISA

Sign In for Pricing
View Details