Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF843 Peptide - N-terminal region

ZNF843 Peptide - N-terminal region

Product Specifications

UniProt

Q8N446

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF843 Rabbit Polyclonal Antibody (orb575911) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129981

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WRETLSLSPVRQDLLWPLQPHQAPASPLGRSHSSAGVRQGFSGQLCCWLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PVRL1 (NECTIN1) (NM_002855) Human Mass Spec Standard
PH311214 10 µg

PVRL1 (NECTIN1) (NM_002855) Human Mass Spec Standard

Sign In for Pricing
View Details
Mouse RILP-like protein 2, RILPL2 ELISA KIT
E2432Mo-01 48 Well

Mouse RILP-like protein 2, RILPL2 ELISA KIT

Sign In for Pricing
View Details
Mouse RILP-like protein 2, RILPL2 ELISA KIT
E2432Mo-02 96 Well

Mouse RILP-like protein 2, RILPL2 ELISA KIT

Sign In for Pricing
View Details
Mouse RILP-like protein 2, RILPL2 ELISA KIT
E2432Mo-03 5x 96 Tests

Mouse RILP-like protein 2, RILPL2 ELISA KIT

Sign In for Pricing
View Details
Mouse RILP-like protein 2, RILPL2 ELISA KIT
E2432Mo-04 10x 96 Tests

Mouse RILP-like protein 2, RILPL2 ELISA KIT

Sign In for Pricing
View Details
COPZ2 Protein Lysate (Human) with C-Ha Tag
16639031 100 µg

COPZ2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details