Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF843 Peptide - N-terminal region

ZNF843 Peptide - N-terminal region

Product Specifications

UniProt

Q8N446

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF843 Rabbit Polyclonal Antibody (orb575911) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129981

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WRETLSLSPVRQDLLWPLQPHQAPASPLGRSHSSAGVRQGFSGQLCCWLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sutezolid sulfoxide
CS-O-48616 1 Each

Sutezolid sulfoxide

Sign In for Pricing
View Details
HIST2H3C2 siRNA (Mouse)
CRN0356-01 15 nmol

HIST2H3C2 siRNA (Mouse)

Sign In for Pricing
View Details
HIST2H3C2 siRNA (Mouse)
CRN0356-02 30 nmol

HIST2H3C2 siRNA (Mouse)

Sign In for Pricing
View Details
Tmub2 (NM_028076) Mouse Recombinant Protein
TP504613 20 µg

Tmub2 (NM_028076) Mouse Recombinant Protein

Sign In for Pricing
View Details
PSEN1 Rabbit pAb
E2502187 100 µL

PSEN1 Rabbit pAb

Sign In for Pricing
View Details
OPN5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV657326 1.0 µg DNA

OPN5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details