Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA7 Peptide - C-terminal region

CHRNA7 Peptide - C-terminal region

Product Specifications

UniProt

Q5W554

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRNA7 Rabbit Polyclonal Antibody (orb576024) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human INTU knockout cell line
ABC-KH7424 1 Vial

Human INTU knockout cell line

Sign In for Pricing
View Details
CD71/TfR (Ab-24) Antibody
E11-0852B 100 µg

CD71/TfR (Ab-24) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Ctdspl2 shRNA (UAS) - Lentiviral mouse Ctdspl2 shRNA (UAS, iRFP) plasmid
GTR15296815 1 Vial

Lentiviral mouse Ctdspl2 shRNA (UAS) - Lentiviral mouse Ctdspl2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
2-Amino-4-hydroxybenzoic acid
TRC-A636425-50MG 50 mg

2-Amino-4-hydroxybenzoic acid

Sign In for Pricing
View Details
SUPT16H Rabbit Polyclonal Antibody
TA363718 100 µL

SUPT16H Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1,2-Isopropylidene-3-oleoyl-sn-glycerol
280552 10 g

1,2-Isopropylidene-3-oleoyl-sn-glycerol

Sign In for Pricing
View Details