Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA7 Peptide - C-terminal region

CHRNA7 Peptide - C-terminal region

Product Specifications

UniProt

Q5W554

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRNA7 Rabbit Polyclonal Antibody (orb576024) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRF2 (TERF2) Human qPCR Template Standard (NM_005652)
HK209732 1 Kit

TRF2 (TERF2) Human qPCR Template Standard (NM_005652)

Sign In for Pricing
View Details
Jarid1C Rabbit Polyclonal Antibody (PE-Cy7)
orb961097 100 µL

Jarid1C Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Brn-2 CRISPR Activation Plasmid (h2)
sc-400392-ACT-2 20 µg

Brn-2 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Phospho-Serine Rabbit Polyclonal Antibody (PerCP)
orb2538865 100 µL

Phospho-Serine Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
WDR88, CT (WDR88, PQWD, WD repeat-containing protein 88, PQQ repeat and WD repeat-containing protein) (MaxLight 650)
MBS6363464-01 0.1 mL

WDR88, CT (WDR88, PQWD, WD repeat-containing protein 88, PQQ repeat and WD repeat-containing protein) (MaxLight 650)

Sign In for Pricing
View Details
WDR88, CT (WDR88, PQWD, WD repeat-containing protein 88, PQQ repeat and WD repeat-containing protein) (MaxLight 650)
MBS6363464-02 5x 0.1 mL

WDR88, CT (WDR88, PQWD, WD repeat-containing protein 88, PQQ repeat and WD repeat-containing protein) (MaxLight 650)

Sign In for Pricing
View Details