Tcfl5 Peptide - N-terminal region
Tcfl5 Peptide - N-terminal region
Product Specifications
UniProt
Q3V133
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TCFL5 Rabbit Polyclonal Antibody (orb576343) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKTPGGADGTRTRADGVAKEGAGGAGPDGAPEARAKPTVRVRLEDRFNSM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PI 3 Kinase catalytic subunit alpha (PIK3CA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A7]](https://cdn.genprice.uk/products/937/6868c3a0994c49e6dc3fb247/imageurl/ta801482am.webp)
TA801482AM 100 µL
PI 3 Kinase catalytic subunit alpha (PIK3CA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A7]
Sign In for Pricing
View Details 
BNC470967-500 1x 500 µL
Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470493-500 1x 500 µL
Moesin (MSN/493), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
