Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNGA4 Peptide - N-terminal region

CNGA4 Peptide - N-terminal region

Product Specifications

UniProt

Q8IV77

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNGA4 Rabbit Polyclonal Antibody (orb579308) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAAH2 Polyclonal Antibody
E-AB-11206-01 20 µL

FAAH2 Polyclonal Antibody

Sign In for Pricing
View Details
FAAH2 Polyclonal Antibody
E-AB-11206-02 60 µL

FAAH2 Polyclonal Antibody

Sign In for Pricing
View Details
FAAH2 Polyclonal Antibody
E-AB-11206-03 120 µL

FAAH2 Polyclonal Antibody

Sign In for Pricing
View Details
FAAH2 Polyclonal Antibody
E-AB-11206-04 200 µL

FAAH2 Polyclonal Antibody

Sign In for Pricing
View Details
2-(2,3-Dihydro-1,3-dioxo-1H-inden-2-yl)-6-quinolinesulfonic Acid Sodium Salt
TRC-D848640-250MG 250 mg

2-(2,3-Dihydro-1,3-dioxo-1H-inden-2-yl)-6-quinolinesulfonic Acid Sodium Salt

Sign In for Pricing
View Details
MelanA (MLANA) Mouse Monoclonal Antibody [Clone ID: OTI6B12]
CF807226 100 µg

MelanA (MLANA) Mouse Monoclonal Antibody [Clone ID: OTI6B12]

Sign In for Pricing
View Details