Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNGA4 Peptide - N-terminal region

CNGA4 Peptide - N-terminal region

Product Specifications

UniProt

Q8IV77

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNGA4 Rabbit Polyclonal Antibody (orb579308) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GREM1 Antibody
KC-3795-01 50 μL

GREM1 Antibody

Sign In for Pricing
View Details
GREM1 Antibody
KC-3795-02 100 µL

GREM1 Antibody

Sign In for Pricing
View Details
GREM1 Antibody
KC-3795-03 1 mL

GREM1 Antibody

Sign In for Pricing
View Details
Peroxiredoxin-6 Antibody
KC-982-01 50 μL

Peroxiredoxin-6 Antibody

Sign In for Pricing
View Details
Peroxiredoxin-6 Antibody
KC-982-02 100 µL

Peroxiredoxin-6 Antibody

Sign In for Pricing
View Details
Peroxiredoxin-6 Antibody
KC-982-03 1 mL

Peroxiredoxin-6 Antibody

Sign In for Pricing
View Details