Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL12RB2 Peptide - middle region

IL12RB2 Peptide - middle region

Product Specifications

UniProt

Q99665

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL12RB2 Rabbit Polyclonal Antibody (orb579393) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHYQVTLQELTGGKAMTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dexloxiglumide
orb1707384-01 5 mg

Dexloxiglumide

Sign In for Pricing
View Details
Dexloxiglumide
orb1707384-02 10 mg

Dexloxiglumide

Sign In for Pricing
View Details
CaMKIIδ Double Nickase Plasmid (h2)
sc-400811-NIC-2 20 µg

CaMKIIδ Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Shaker 15 Kg SS Clamp 1 No, 100 ml
100S01001SC015 1 Unit

Shaker 15 Kg SS Clamp 1 No, 100 ml

Sign In for Pricing
View Details
Rabbit HFE2 ELISA Kit
ERTH0247 96 Tests

Rabbit HFE2 ELISA Kit

Sign In for Pricing
View Details
pECMV-Ptprc-m-FLAG Plasmid
PVT15573 2 µg

pECMV-Ptprc-m-FLAG Plasmid

Sign In for Pricing
View Details