Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL16 Peptide - middle region

METTL16 Peptide - middle region

Product Specifications

Product Name Alternative

METT10D

UniProt

Q86W50

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with METTL16 Rabbit Polyclonal Antibody (orb325358) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076991

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGRTMRWALAWSFYDDVTVPSPPSKRRKLEKPRKPITFVVLASVMKELSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Gliadin IgG2a Antibody Assay Kit
3053 1 Kit

Mouse Anti-Gliadin IgG2a Antibody Assay Kit

Sign In for Pricing
View Details
CMD1D sgRNA CRISPR Lentivector (Human) (Target 2)
K0470803 1.0 µg DNA

CMD1D sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Human CCDC56, GST-tagged
CCDC56-10809H 25 µg

Recombinant Human CCDC56, GST-tagged

Sign In for Pricing
View Details
Canine ORM ELISA Kit
ECO0331 96 Tests

Canine ORM ELISA Kit

Sign In for Pricing
View Details
OR4F6 (NM_001005326) Human Tagged Lenti ORF Clone
RC218339L4 10 µg

OR4F6 (NM_001005326) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RASA2 AAV Vector (Mouse) (CMV)
38523104 1 µg

RASA2 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details