Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHTF2 Peptide - C-terminal region

PHTF2 Peptide - C-terminal region

Product Specifications

UniProt

B3KQZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHTF2 Rabbit Polyclonal Antibody (orb580759) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTPFVFRLSQATDLEQLTAHSASELYVIAFGSNEDVIVLSMVIISFVVRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC38A4 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
44171064 1.0 µg DNA

SLC38A4 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human PLP-Ab (PLP-Ab) ELISA Kit
YP-W16996-01 48 Tests

Human PLP-Ab (PLP-Ab) ELISA Kit

Sign In for Pricing
View Details
Human PLP-Ab (PLP-Ab) ELISA Kit
YP-W16996-02 96 Tests

Human PLP-Ab (PLP-Ab) ELISA Kit

Sign In for Pricing
View Details
Rat Nerve Growth Factor IB (NGFIB) ELISA Kit
DL-NGFIB-Ra-01 48 Tests

Rat Nerve Growth Factor IB (NGFIB) ELISA Kit

Sign In for Pricing
View Details
Rat Nerve Growth Factor IB (NGFIB) ELISA Kit
DL-NGFIB-Ra-02 96 Tests

Rat Nerve Growth Factor IB (NGFIB) ELISA Kit

Sign In for Pricing
View Details
Elf-1 (C-4) X
sc-133096 X 200 µg - 0.1 mL

Elf-1 (C-4) X

Sign In for Pricing
View Details